PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g076000.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 241aa    MW: 26840.1 Da    PI: 8.3889
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g076000.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.65.8e-201977457
                        -SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  4 RttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        R+++tkeq++ Le+l+++  r+psa+++++++ +l    +++ ++V++WFqN++a++++
  Solyc06g076000.1.1 19 RWNPTKEQIDLLESLYKQgIRTPSADQIQQITGRLrafgHIEGKNVFYWFQNHKARQRQ 77
                        9****************99**************************************97 PP

2Wus_type_Homeobox113.79.4e-371879465
   Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         RW+Pt+eQi +Le+lyk+G+rtP++++iq+it +L+++G+ie+kNVfyWFQN+kaR+rqkq
  Solyc06g076000.1.1 18 CRWNPTKEQIDLLESLYKQGIRTPSADQIQQITGRLRAFGHIEGKNVFYWFQNHKARQRQKQ 79
                        6***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.9E-41582IPR001356Homeobox domain
SuperFamilySSF466898.98E-121682IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-81877IPR009057Homeodomain-like
PfamPF000461.5E-171977IPR001356Homeobox domain
CDDcd000861.56E-61979No hitNo description
PROSITE profilePS5007110.3652378IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MSDSSVDMIT SGGSPVGCRW NPTKEQIDLL ESLYKQGIRT PSADQIQQIT GRLRAFGHIE  60
GKNVFYWFQN HKARQRQKQK QDKFAYYNRF LHRTSVFPPP NCPNGFVVVC SPYYTAQNNL  120
GFYQQYPAVP SMIIPGPGGF KRRATCNQET LNLCEQNNSP NANKEFITQE TLNLFPLHPT  180
GVLQEKTTIA DSSSSSSTCV PRDHLSSNTT SNSVEVNCFT DLGIGASDRP QPVFNFLCGN  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015079052.11e-168PREDICTED: WUSCHEL-related homeobox 2-like
SwissprotQ6X7K15e-53WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLK4C9W10.0K4C9W1_SOLLC; Uncharacterized protein
STRINGSolyc06g076000.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Representative plantOGRP85821116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-43WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]